PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01509.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 210aa    MW: 24232.2 Da    PI: 8.936
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01509.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.8e-131859142
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42
                             +g WT+eEd +l d+v  +G+g+W++I r+ g++R++k+c++
  Rsa1.0_01509.1_g00002.1 18 KGLWTAEEDNILRDYVLTHGKGQWNRIVRKTGLKRCGKSCRL 59
                             678*************************************95 PP

2Myb_DNA-binding46.21.1e-1459941148
                             HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
  Rsa1.0_01509.1_g00002.1 59 LIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNHWNTHL 94
                             6899********.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-141358IPR009057Homeodomain-like
PROSITE profilePS5129418.2631398IPR017930Myb domain
SuperFamilySSF466891.84E-201690IPR009057Homeodomain-like
SMARTSM007173.4E-151796IPR001005SANT/Myb domain
PfamPF139211.6E-52158No hitNo description
CDDcd001676.16E-112194No hitNo description
Gene3DG3DSA:1.10.10.601.2E-175994IPR009057Homeodomain-like
PfamPF002494.4E-135994IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MRRTRRTDEG ENHQEYKKGL WTAEEDNILR DYVLTHGKGQ WNRIVRKTGL KRCGKSCRLI  60
IRLHKLLGNR WSLIAKRVPG RTDNQVKNHW NTHLSKKIVG DYSSAVKTTG EENYPPSLLI  120
TGATASCHHQ QDKICDKSFE GLVSASYENK PKAGLTQREV MVENTNDSSI YFKERNNFDS  180
SNAFWFNEDD FEMNSFVMMD FASGDIGYCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-1518987108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7473470.0AB747347.1 Raphanus sativus var. niger RsGL1b gene for glabrous 1, complete cds, strain: Ra38 DH line.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151910.11e-127PREDICTED: trichome differentiation protein GL1
SwissprotP279001e-102GL1_ARATH; Trichome differentiation protein GL1
TrEMBLK0IRR71e-159K0IRR7_RAPSA; Glabrous 1
STRINGBra025311.1-P1e-126(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27920.11e-103myb domain protein 0